McDonnell Genome Institute

Washington University

Transcript

lnc-SRSF6-3:3

Chromosome

chr20

Gene Name

lnc-SRSF6-3

Start

42685482

CPC Label

noncoding

End

42688562

Cancer

OV

Strand

+

Peptide

LDSKALESK

Modified Peptide

n[145]LDSKALESK

Peptide Length

9

ORF Length

56

Open Reading Frame (ORF)

LDSKALESKAMLQEHLVPGQHGFTNGHPSLPSPTSAKQPCYEEWGERNSCLIQFGS

Conservation Score

0.918

PhyloCSF Frame 1

-4.823

No. of Spectra

3

CPC Coding Probability

0.133463

PhyloCSF Frame 2 

-5.049

CNTI Index

noncoding

Max Probability

0.8559

PhyloCSF Frame 3

-2.712

CNTI Score

-0.389727923