McDonnell Genome Institute

Washington University

Transcript

lnc-SRSF6-3:1

Chromosome

chr20

Gene Name

lnc-SRSF6-3

Start

42685482

CPC Label

noncoding

End

42687645

Cancer

OV

Strand

+

Peptide

VNILEEPSFPCLLIR

Modified Peptide

n[145]VNILEEPSFPCLLIR

Peptide Length

15

ORF Length

58

Open Reading Frame (ORF)

MKFYDLQHSVCPGSPLSPKTSTFSRLLFAGPLPKIKSRVNILEEPSFPCLLIRSPQKA

Conservation Score

1

PhyloCSF Frame 1

-4.818

No. of Spectra

2

CPC Coding Probability

0.157629

PhyloCSF Frame 2 

-5.304

CNTI Index

noncoding

Max Probability

0.8996

PhyloCSF Frame 3

-3.451

CNTI Score

-0.411964599