McDonnell Genome Institute

Washington University

Transcript

lnc-SRSF2-9:2

Chromosome

chr17

Gene Name

lnc-SRSF2-9

Start

77386359

CPC Label

noncoding

End

77388817

Cancer

CCRC

Strand

-

Peptide

LNSDPQK

Modified Peptide

LNSDPQK

Peptide Length

7

ORF Length

41

Open Reading Frame (ORF)

LNSDPQKTCQSPSPRTCECDRSWNRVFADAIKDLKRRVSWI

Conservation Score

0.043

PhyloCSF Frame 1

-4.251

No. of Spectra

15

CPC Coding Probability

0.0799453

PhyloCSF Frame 2 

-3.566

CNTI Index

noncoding

Max Probability

0.9953

PhyloCSF Frame 3

-3.212

CNTI Score

-0.320080198