McDonnell Genome Institute

Washington University

Transcript

lnc-SRSF2-9:1

Chromosome

chr17

Gene Name

lnc-SRSF2-9

Start

77383392

CPC Label

coding

End

77392477

Cancer

CCRC

Strand

-

Peptide

HLDLWAK

Modified Peptide

n[230]HLDLWAK

Peptide Length

7

ORF Length

96

Open Reading Frame (ORF)

LSQLRTLARASSFQRHSRRGLGAGTRRTSPLHPPGQRSRTLPLAHIPCGQKCRSKQCWQRHLDLWAKQGLHLTPQAWSTRKPAQASGPLTASDQGM

Conservation Score

0.8

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.618547

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9967

PhyloCSF Frame 3

0

CNTI Score

-0.280066707