McDonnell Genome Institute

Washington University

Transcript

lnc-SRSF2-2:4

Chromosome

chr17

Gene Name

lnc-SRSF2-2

Start

76950295

CPC Label

coding

End

76969204

Cancer

OV

Strand

-

Peptide

GGPGGATGHTGQK

Modified Peptide

n[145]GGPGGATGHTGQK

Peptide Length

13

ORF Length

90

Open Reading Frame (ORF)

LKSCLCRLQSGSPGPGLGCQEHSGLRRGFQSVGQGWGKGGPGGATGHTGQKHLPPGWHFTFGKLLHWIMKTFVFSKARKKRITITTSQGT

Conservation Score

0.456

PhyloCSF Frame 1

-4.719

No. of Spectra

2

CPC Coding Probability

0.568606

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7823

PhyloCSF Frame 3

0

CNTI Score

-0.306613824