McDonnell Genome Institute

Washington University

Transcript

lnc-SRSF12-2:1

Chromosome

chr6

Gene Name

lnc-SRSF12-2

Start

89080715

CPC Label

noncoding

End

89081021

Cancer

OV

Strand

-

Peptide

RWMLLGEPEK

Modified Peptide

n[145]RWMLLGEPEK

Peptide Length

10

ORF Length

43

Open Reading Frame (ORF)

MKPVKIGWRRWMLLGEPEKIAEHDSGGGGAATNSHSPSSECCY

Conservation Score

1

PhyloCSF Frame 1

2.578

No. of Spectra

3

CPC Coding Probability

0.0297565

PhyloCSF Frame 2 

-2.864

CNTI Index

noncoding

Max Probability

0.7072

PhyloCSF Frame 3

1.032

CNTI Score

-0.29155793