McDonnell Genome Institute

Washington University

Transcript

lnc-SRSF10-1:1

Chromosome

chr1

Gene Name

lnc-SRSF10-1

Start

23949015

CPC Label

noncoding

End

23949383

Cancer

EOGC

Strand

-

Peptide

FQSSAVGTLQEAGEDYLVGLFEDNNLCAIHAK

Modified Peptide

n[145]FQSSAVGTLQEAGEDYLVGLFEDNNLCAIHAK

Peptide Length

32

ORF Length

54

Open Reading Frame (ORF)

LRFQSSAVGTLQEAGEDYLVGLFEDNNLCAIHAKRVTIMPKDMQLARRIRGERA

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

509

CPC Coding Probability

0.127199

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

0

CNTI Score

-0.375412347