McDonnell Genome Institute

Washington University

Transcript

lnc-SRRM3-5:1

Chromosome

chr7

Gene Name

lnc-SRRM3-5

Start

76164733

CPC Label

noncoding

End

76165168

Cancer

OV

Strand

+

Peptide

TQHSSRSLMAGFSR

Modified Peptide

n[145]TQHSSRSLM[147]AGFSR

Peptide Length

14

ORF Length

36

Open Reading Frame (ORF)

LASSDPPVSASQSAGITGVSHRTQHSSRSLMAGFSR

Conservation Score

0.075

PhyloCSF Frame 1

0

No. of Spectra

154

CPC Coding Probability

0.245429

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8387

PhyloCSF Frame 3

0

CNTI Score

-0.376156932