McDonnell Genome Institute

Washington University

Transcript

lnc-SRRD-1:10

Chromosome

chr22

Gene Name

lnc-SRRD-1

Start

26512546

CPC Label

noncoding

End

26521044

Cancer

OV

Strand

+

Peptide

DLLSFPRGEK

Modified Peptide

n[145]DLLSFPRGEK

Peptide Length

10

ORF Length

59

Open Reading Frame (ORF)

LGSNAQPLKNKEKFYKATRALGSRSHIYRDLLSFPRGEKKKQKHCFEIWEHPHSFLHSQ

Conservation Score

0.364

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.273492

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.2896

PhyloCSF Frame 3

0

CNTI Score

-0.342751203