McDonnell Genome Institute

Washington University

Transcript

lnc-SRPRB-3:1

Chromosome

chr3

Gene Name

lnc-SRPRB-3

Start

133760299

CPC Label

coding

End

133762363

Cancer

HCC

Strand

+

Peptide

SVSSLSGWASILYSGCDTIDK

Modified Peptide

n[230]SVSSLSGWASILYSGCDTIDK

Peptide Length

21

ORF Length

62

Open Reading Frame (ORF)

LSQDKKNQTKLKQSLQIQNLSLYKSVSSLSGWASILYSGCDTIDKVFYVCKKKEEQKTLGNM

Conservation Score

1

PhyloCSF Frame 1

-4.097

No. of Spectra

3

CPC Coding Probability

0.667384

PhyloCSF Frame 2 

-4.795

CNTI Index

noncoding

Max Probability

0.9985

PhyloCSF Frame 3

-4.921

CNTI Score

-0.400668697