McDonnell Genome Institute

Washington University

Transcript

lnc-SRPK2-1:9

Chromosome

chr7

Gene Name

lnc-SRPK2-1

Start

104981746

CPC Label

noncoding

End

104991165

Cancer

CRC

Strand

-

Peptide

VLSGPTK

Modified Peptide

‚Äč

Peptide Length

7

ORF Length

41

Open Reading Frame (ORF)

LGCSDSSTSATQNWDYGCEPPHLASYILIKVLSGPTKVQFA

Conservation Score

0.08

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.128649

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.8963

PhyloCSF Frame 3

0

CNTI Score

0.622268144