McDonnell Genome Institute

Washington University

Transcript

lnc-SRPK1-2:1

Chromosome

chr6

Gene Name

lnc-SRPK1-2

Start

35989514

CPC Label

noncoding

End

35990436

Cancer

BRCA-Luminal A

Strand

-

Peptide

MDMYPTEK

Modified Peptide

n[145]MDMYPTEK

Peptide Length

8

ORF Length

71

Open Reading Frame (ORF)

MHSQREHMMFMEKQLEDLNILFNKNPYPNLSLQKEMASKMDMYPTEKKQNKTQESKMQAYSANTISTTAIS

Conservation Score

0.477

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0809341

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0785

PhyloCSF Frame 3

0

CNTI Score

-0.418322068