McDonnell Genome Institute

Washington University

Transcript

lnc-SRP9-3:1

Chromosome

chr1

Gene Name

lnc-SRP9-3

Start

225795160

CPC Label

noncoding

End

225800974

Cancer

OV

Strand

+

Peptide

MAPPIAPGFNVAATR

Modified Peptide

n[145]MAPPIAPGFNVAATR

Peptide Length

15

ORF Length

92

Open Reading Frame (ORF)

MAPPIAPGFNVAATRAVSFTANSSSRPLWGEEGGGHLLNSAGGTDRLVKYTFFSFPFFSLISSGSCSLHSESEGNFLLSSASFSSESASPSV

Conservation Score

0.664

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.20147

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9601

PhyloCSF Frame 3

0

CNTI Score

-0.32450228