McDonnell Genome Institute

Washington University

Transcript

lnc-SRP9-1:3

Chromosome

chr1

Gene Name

lnc-SRP9-1

Start

225700715

CPC Label

noncoding

End

225716363

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

IGDYSPSC

Modified Peptide

n[145]IGDYSPSC

Peptide Length

8

ORF Length

40

Open Reading Frame (ORF)

MLDCHLCACCLMMARWLQHLWDSRLIFKVPFRIGDYSPSC

Conservation Score

0.253

PhyloCSF Frame 1

-5.008

No. of Spectra

1

CPC Coding Probability

0.234945

PhyloCSF Frame 2 

-3.433

CNTI Index

noncoding

Max Probability

0.9953

PhyloCSF Frame 3

-4.71

CNTI Score

-0.391650993