McDonnell Genome Institute

Washington University

Transcript

lnc-SRP9-1:1

Chromosome

chr1

Gene Name

lnc-SRP9-1

Start

225700603

CPC Label

noncoding

End

225752243

Cancer

BRCA-Luminal A

Strand

+

Peptide

DRAYLSR

Modified Peptide

n[145]DRAYLSR

Peptide Length

7

ORF Length

37

Open Reading Frame (ORF)

LMWCSISAFSMKPRLRPSPFRKQRTRDRAYLSRYSSW

Conservation Score

1

PhyloCSF Frame 1

-2.114

No. of Spectra

33

CPC Coding Probability

0.345825

PhyloCSF Frame 2 

1.197

CNTI Index

noncoding

Max Probability

0.9957

PhyloCSF Frame 3

-1.756

CNTI Score

-0.369318675