McDonnell Genome Institute

Washington University

Transcript

lnc-SRP54-6:1

Chromosome

chr14

Gene Name

lnc-SRP54-6

Start

34694169

CPC Label

noncoding

End

34694644

Cancer

OV

Strand

+

Peptide

IEDNTTLVFTVDVK

Modified Peptide

n[145]IEDNTTLVFTVDVK

Peptide Length

14

ORF Length

59

Open Reading Frame (ORF)

LWTTESAMKKIEDNTTLVFTVDVKANKQQIKQAVKKLCDIDAAKVNTLIRPGGEKKAYV

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.437444

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9197

PhyloCSF Frame 3

0

CNTI Score

0.691336619