McDonnell Genome Institute

Washington University

Transcript

lnc-SRP54-1:3

Chromosome

chr14

Gene Name

lnc-SRP54-1

Start

34874992

CPC Label

noncoding

End

34877064

Cancer

OV

Strand

+

Peptide

GELRPTATSPPLGAPGK

Modified Peptide

n[145]GELRPTATSPPLGAPGK

Peptide Length

17

ORF Length

115

Open Reading Frame (ORF)

LAGRPAQRRQSARRGRTPELLRFVPGSPPLPRRRRPAPERPSPAITPTATCPPSPLQRQRGETPSSQGTASLRPRRAPGCRFSRCHCPTPRGELRPTATSPPLGAPGKFLIYFRL

Conservation Score

1

PhyloCSF Frame 1

0.001

No. of Spectra

15

CPC Coding Probability

0.0156144

PhyloCSF Frame 2 

-0.432

CNTI Index

noncoding

Max Probability

0.9771

PhyloCSF Frame 3

2.59

CNTI Score

-0.317976976