McDonnell Genome Institute

Washington University

Transcript

lnc-SRGAP2C-5:1

Chromosome

chr1

Gene Name

lnc-SRGAP2C-5

Start

121396753

CPC Label

noncoding

End

121463129

Cancer

HCC

Strand

+

Peptide

VALPVEAVGEK

Modified Peptide

VALPVEAVGEK

Peptide Length

11

ORF Length

100

Open Reading Frame (ORF)

LHRVALPVEAVGEKKEGGGGGDAAATEGGTGAAASRALQQCGQLQKLIVIFIGSLCGLCTKCAVSNDLTQQEIQTLELGDDILIYEMQEDVMCGTSMKTD

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.153303

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9063

PhyloCSF Frame 3

0

CNTI Score

-0.272690797