McDonnell Genome Institute

Washington University

Transcript

lnc-SRGAP2C-14:1

Chromosome

chr1

Gene Name

lnc-SRGAP2C-14

Start

121502343

CPC Label

noncoding

End

121503891

Cancer

CCRC

Strand

+

Peptide

ACEVLTGGSMNK

Modified Peptide

n[230]ACEVLTGGSM[147]NK

Peptide Length

12

ORF Length

73

Open Reading Frame (ORF)

LVAGKSWAKVHLMFDENGKTICEPYPSMAEGIIGWRDLPSAGDEILEVEPELRACEVLTGGSMNKNRRKVNRI

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0596691

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7912

PhyloCSF Frame 3

0

CNTI Score

-0.310609649