McDonnell Genome Institute

Washington University

Transcript

lnc-SREK1-1:1

Chromosome

chr5

Gene Name

lnc-SREK1-1

Start

66196288

CPC Label

noncoding

End

66571973

Cancer

OV

Strand

+

Peptide

SLAGSHLAFTFLK

Modified Peptide

n[145]SLAGSHLAFTFLK

Peptide Length

13

ORF Length

41

Open Reading Frame (ORF)

LFLYQKYRNGNRKQVTFPGIASKSLAGSHLAFTFLKFSIMI

Conservation Score

0.043

PhyloCSF Frame 1

-5.56

No. of Spectra

6

CPC Coding Probability

0.323011

PhyloCSF Frame 2 

-5.291

CNTI Index

noncoding

Max Probability

0.9926

PhyloCSF Frame 3

-6.142

CNTI Score

-0.389197361