McDonnell Genome Institute

Washington University

Transcript

lnc-SRCIN1-1:2

Chromosome

chr17

Gene Name

lnc-SRCIN1-1

Start

38450587

CPC Label

noncoding

End

38452444

Cancer

PRAD

Strand

-

Peptide

VAQWGGQTLLDQLEPPSR

Modified Peptide

Peptide Length

18

ORF Length

76

Open Reading Frame (ORF)

LSPARTCGRVAQWGGQTLLDQLEPPSRCPQPCQTLGPQAEGNQMSSAPSLASPPSKQPTAETLERINHIQCPFPAL

Conservation Score

1

PhyloCSF Frame 1

-4.924

No. of Spectra

3

CPC Coding Probability

0.213105

PhyloCSF Frame 2 

-4.533

CNTI Index

noncoding

Max Probability

0.7971

PhyloCSF Frame 3

-3.081

CNTI Score

-0.353390954