McDonnell Genome Institute

Washington University

Transcript

lnc-SRBD1-1:1

Chromosome

chr2

Gene Name

lnc-SRBD1-1

Start

45648742

CPC Label

coding

End

45650825

Cancer

BRCA-Luminal B

Strand

-

Peptide

GLGTLPLPTPTR

Modified Peptide

n[145]GLGTLPLPTPTR

Peptide Length

12

ORF Length

286

Open Reading Frame (ORF)

MGEWRGPCCPRGLGTLPLPTPTRAAAGRSSLRSSGPSVTLSRDAVIHGGGGGGRGRDKHGSGEVLNSVLLSCLSLGTFSPLGSVLDFAGCENLLTSESSVEPRLGLWSAYFLQSDCSCLRWSLSVPLWGTSALISALTAAVRAAGKWGAPSGGRVAVSLLISSVTFKLSLEATAAAGHVRRALGCWGKISSAGSRDRAGGRRGTAPRPRLGTWEGRAGALGPGARPSWDTREDGGGEEVGSAAGELGIMQMGKENLRPRPSAKSSLGICRYCGHVMEGSGKYGLIF

Conservation Score

1

PhyloCSF Frame 1

-0.558

No. of Spectra

66

CPC Coding Probability

0.989128

PhyloCSF Frame 2 

0.398

CNTI Index

noncoding

Max Probability

0.9979

PhyloCSF Frame 3

2.64

CNTI Score

-0.311987855