McDonnell Genome Institute

Washington University

Transcript

lnc-SRARP-1:1

Chromosome

chr1

Gene Name

lnc-SRARP-1

Start

15989870

CPC Label

noncoding

End

15994751

Cancer

BRCA-Luminal A

Strand

+

Peptide

LGLYEETR

Modified Peptide

n[145]LGLYEETR

Peptide Length

8

ORF Length

86

Open Reading Frame (ORF)

LGLYEETRKPGDLPPPAKPEQGSLAPRPGLASPGRKTLWQGDRQAPPGPTTRFQWPIWPASPPWVARLVSFPSMGASRPFSGGTGD

Conservation Score

0.649

PhyloCSF Frame 1

0

No. of Spectra

49

CPC Coding Probability

0.17334

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

0

CNTI Score

-0.338188243