McDonnell Genome Institute

Washington University

Transcript

lnc-SQOR-1:6

Chromosome

chr15

Gene Name

lnc-SQOR-1

Start

45705183

CPC Label

noncoding

End

45717444

Cancer

PRAD

Strand

+

Peptide

GPAQMPEGR

Modified Peptide

‚Äč

Peptide Length

9

ORF Length

55

Open Reading Frame (ORF)

LGAHVGISPVDGHWAVCWLLLIKGPAQMPEGRMTIVTPQLWPCRTLMESGVSDYL

Conservation Score

0.16

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.171773

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7589

PhyloCSF Frame 3

0

CNTI Score

-0.380385274