McDonnell Genome Institute

Washington University

Transcript

lnc-SQOR-1:1

Chromosome

chr15

Gene Name

lnc-SQOR-1

Start

45704689

CPC Label

coding

End

45713827

Cancer

OV

Strand

+

Peptide

AGVEDLR

Modified Peptide

n[145]AGVEDLR

Peptide Length

7

ORF Length

47

Open Reading Frame (ORF)

LFVHLVWREKGPEVAYMDSWGVVTDLVASLERAGVEDLRARVRVRCG

Conservation Score

0.173

PhyloCSF Frame 1

-5.822

No. of Spectra

3

CPC Coding Probability

0.750836

PhyloCSF Frame 2 

-4.423

CNTI Index

coding

Max Probability

0.8697

PhyloCSF Frame 3

-4.2

CNTI Score

0.668409478