McDonnell Genome Institute

Washington University

Transcript

lnc-SPZ1-1:10

Chromosome

chr5

Gene Name

lnc-SPZ1-1

Start

80257099

CPC Label

noncoding

End

80258384

Cancer

OV

Strand

+

Peptide

QLFFFFFFFFLRQSLAQSPR

Modified Peptide

n[145]QLFFFFFFFFLRQSLAQSPR

Peptide Length

20

ORF Length

72

Open Reading Frame (ORF)

LLRELLLHERLYITRQLFFFFFFFFLRQSLAQSPRLECIGMIPAHCNLRPPGSSDSPASASEVAGITGARHR

Conservation Score

0.545

PhyloCSF Frame 1

0

No. of Spectra

19

CPC Coding Probability

0.0209039

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5515

PhyloCSF Frame 3

0

CNTI Score

-0.372816848