McDonnell Genome Institute

Washington University

Transcript

lnc-SPTSSB-2:1

Chromosome

chr3

Gene Name

lnc-SPTSSB-2

Start

161328923

CPC Label

noncoding

End

161330238

Cancer

OV

Strand

-

Peptide

TPQETYADTGGK

Modified Peptide

n[145]TPQETYADTGGK

Peptide Length

12

ORF Length

50

Open Reading Frame (ORF)

LLEPGCSVLLSHKVHAVIGVLMDDTDPLFTVMKVEKTPQETYADTGGKVG

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0667492

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9924

PhyloCSF Frame 3

0

CNTI Score

-0.330721217