McDonnell Genome Institute

Washington University

Transcript

lnc-SPTLC3-7:1

Chromosome

chr20

Gene Name

lnc-SPTLC3-7

Start

12883810

CPC Label

noncoding

End

12886553

Cancer

EOGC

Strand

+

Peptide

MAPVSEPDGQSKMTCPASR

Modified Peptide

n[145]MAPVSEPDGQSKMTCPASR

Peptide Length

19

ORF Length

60

Open Reading Frame (ORF)

MAPVSEPDGQSKMTCPASRIIISKITGILIGKETKHLSCPLRKTSHVPPKYIHLLCTHKN

Conservation Score

0.23

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0366018

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4214

PhyloCSF Frame 3

0

CNTI Score

-0.437667689