McDonnell Genome Institute

Washington University

Transcript

lnc-SPTLC1-3:1

Chromosome

chr9

Gene Name

lnc-SPTLC1-3

Start

92131151

CPC Label

noncoding

End

92135601

Cancer

OV

Strand

-

Peptide

MLPEPSGPSLASWVTSAYR

Modified Peptide

n[145]M[147]LPEPSGPSLASWVTSAYR

Peptide Length

19

ORF Length

73

Open Reading Frame (ORF)

MAQISHFLPQLPKGRDDADQLFLEGGSYVSPIRMLPEPSGPSLASWVTSAYRGCLGREVIRVSGFPLILRLLS

Conservation Score

1

PhyloCSF Frame 1

-3.848

No. of Spectra

1

CPC Coding Probability

0.18236

PhyloCSF Frame 2 

-3.674

CNTI Index

noncoding

Max Probability

0.1155

PhyloCSF Frame 3

6.637

CNTI Score

-0.304336546