McDonnell Genome Institute

Washington University

Transcript

lnc-SPTBN5-5:1

Chromosome

chr15

Gene Name

lnc-SPTBN5-5

Start

41718369

CPC Label

noncoding

End

41718672

Cancer

EOGC

Strand

-

Peptide

AVDSQIVR

Modified Peptide

n[145]AVDSQIVR

Peptide Length

8

ORF Length

67

Open Reading Frame (ORF)

LQKPRHQEGEISDTEKENYKTTEQCKIDQKAVDSQIVRKIKAIPQLQGYLRSVFALTNGIYPHKLVF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

14

CPC Coding Probability

0.131462

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9974

PhyloCSF Frame 3

0

CNTI Score

0.673785743