McDonnell Genome Institute

Washington University

Transcript

lnc-SPTBN5-2:1

Chromosome

chr15

Gene Name

lnc-SPTBN5-2

Start

41769939

CPC Label

noncoding

End

41773080

Cancer

OV

Strand

-

Peptide

LVIEEPSIR

Modified Peptide

n[145]LVIEEPSIR

Peptide Length

9

ORF Length

37

Open Reading Frame (ORF)

MDCLPFLCVQNIFKLVIEEPSIRYFICNSTKKLLYVL

Conservation Score

1

PhyloCSF Frame 1

-5.928

No. of Spectra

2

CPC Coding Probability

0.0383384

PhyloCSF Frame 2 

-3.757

CNTI Index

noncoding

Max Probability

0.5265

PhyloCSF Frame 3

-4.756

CNTI Score

-0.375810234