McDonnell Genome Institute

Washington University

Transcript

lnc-SPTBN4-3:1

Chromosome

chr19

Gene Name

lnc-SPTBN4-3

Start

40443435

CPC Label

noncoding

End

40444087

Cancer

OSCC

Strand

+

Peptide

TRTLNSSRQPPSPAK

Modified Peptide

n[145]TRTLNSSRQPPSPAK

Peptide Length

15

ORF Length

114

Open Reading Frame (ORF)

LILPPTSPSLLTFKRPWTSPPNSLSGSKTRTLNSSRQPPSPAKHDKAPNSTRPEDPSGIESPGSLSQKFLPSVLSLLQKPNVPASNSLHLKILPQQPRLPSWVLNSVSGPQTLP

Conservation Score

1

PhyloCSF Frame 1

-1.991

No. of Spectra

1

CPC Coding Probability

0.00265884

PhyloCSF Frame 2 

-2.57

CNTI Index

noncoding

Max Probability

0.8797

PhyloCSF Frame 3

-4.783

CNTI Score

-0.402442789