McDonnell Genome Institute

Washington University

Transcript

lnc-SPTBN2-2:1

Chromosome

chr11

Gene Name

lnc-SPTBN2-2

Start

66742891

CPC Label

noncoding

End

66744563

Cancer

EOGC

Strand

-

Peptide

ILPPQLQDAR

Modified Peptide

n[145]ILPPQLQDAR

Peptide Length

10

ORF Length

96

Open Reading Frame (ORF)

LMRDSCLAKSCPRRRVGQGVGCFPSGKILPPQLQDARIGQNRLASWQSACPVHNLGATPKNIVYRDLNHTLLESMLSAPPHSSPSQLLTGRPIGAR

Conservation Score

1

PhyloCSF Frame 1

-2.125

No. of Spectra

7

CPC Coding Probability

0.11006

PhyloCSF Frame 2 

-3.403

CNTI Index

noncoding

Max Probability

0.7918

PhyloCSF Frame 3

-2.175

CNTI Score

-0.312564897