McDonnell Genome Institute

Washington University

Transcript

lnc-SPSB2-2:3

Chromosome

chr12

Gene Name

lnc-SPSB2-2

Start

6844798

CPC Label

noncoding

End

6848872

Cancer

OV

Strand

-

Peptide

SALYSAAGR

Modified Peptide

n[145]SALYSAAGR

Peptide Length

9

ORF Length

58

Open Reading Frame (ORF)

LLSASLPVPPLVWGEKQPCQHIPRASDFPMPLARSALYSAAGRHHFHVAGKSTKACLQ

Conservation Score

0.915

PhyloCSF Frame 1

-2.633

No. of Spectra

3

CPC Coding Probability

0.0773718

PhyloCSF Frame 2 

-0.441

CNTI Index

noncoding

Max Probability

0.895

PhyloCSF Frame 3

-2.974

CNTI Score

-0.273993113