McDonnell Genome Institute

Washington University

Transcript

lnc-SPRYD3-1:15

Chromosome

chr12

Gene Name

lnc-SPRYD3-1

Start

53042704

CPC Label

noncoding

End

53046003

Cancer

HCC

Strand

-

Peptide

LEEQLLQLAGK

Modified Peptide

n[230]LEEQLLQLAGK

Peptide Length

11

ORF Length

61

Open Reading Frame (ORF)

LENRDKCTGQKLEEQLLQLAGKSFNWLLILALKSPKLLTEVSRAPFYAPPPCDLKDSLPLS

Conservation Score

0.982

PhyloCSF Frame 1

-4.204

No. of Spectra

3

CPC Coding Probability

0.0123339

PhyloCSF Frame 2 

-3.344

CNTI Index

noncoding

Max Probability

0.9723

PhyloCSF Frame 3

-4.358

CNTI Score

-0.395494484