McDonnell Genome Institute

Washington University

Transcript

lnc-SPRY1-11:6

Chromosome

chr4

Gene Name

lnc-SPRY1-11

Start

123505268

CPC Label

noncoding

End

123508088

Cancer

BRCA-Basal-like

Strand

+

Peptide

LSLCSQAERSTGR

Modified Peptide

n[145]LSLCSQAERSTGR

Peptide Length

13

ORF Length

77

Open Reading Frame (ORF)

LSLCSQAERSTGRKEEGALCAAIVWATGLKQPSDYLIYKVHLNPSQILSVWSGGTQTGTDGAEPLCLRIWKYAFSFT

Conservation Score

1

PhyloCSF Frame 1

-3.056

No. of Spectra

15

CPC Coding Probability

0.0238179

PhyloCSF Frame 2 

0.499

CNTI Index

noncoding

Max Probability

0.969

PhyloCSF Frame 3

-0.833

CNTI Score

-0.316017238