McDonnell Genome Institute

Washington University

Transcript

lnc-SPRY1-11:34

Chromosome

chr4

Gene Name

lnc-SPRY1-11

Start

123709457

CPC Label

noncoding

End

123716405

Cancer

CRC

Strand

+

Peptide

LTGWLDPEDR

Modified Peptide

Peptide Length

10

ORF Length

98

Open Reading Frame (ORF)

LMLSGKCHLLAGGHQDNVQTTPSTSPEPGRLTGWLDPEDRQQSLQFGSQEATSLGKGGEYYIKGIPHGTKESEPQPLALDLPSDRAYPNEKETENQRW

Conservation Score

0.432

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.28123

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.629

PhyloCSF Frame 3

0

CNTI Score

-0.400723519