McDonnell Genome Institute

Washington University

Transcript

lnc-SPRY1-11:10

Chromosome

chr4

Gene Name

lnc-SPRY1-11

Start

123524686

CPC Label

noncoding

End

123527843

Cancer

OSCC

Strand

+

Peptide

TGLECQSK

Modified Peptide

n[145]TGLECQSK

Peptide Length

8

ORF Length

64

Open Reading Frame (ORF)

MLLKGLLSLHEFLIKPKSYPIGAENRSNTILDVTLGSTHTWESTKTGLECQSKKWITLAGRGGS

Conservation Score

0.129

PhyloCSF Frame 1

-4.724

No. of Spectra

1

CPC Coding Probability

0.0407877

PhyloCSF Frame 2 

-2.713

CNTI Index

noncoding

Max Probability

0.3036

PhyloCSF Frame 3

-4.278

CNTI Score

-0.392133102