McDonnell Genome Institute

Washington University

Transcript

lnc-SPRR2D-2:1

Chromosome

chr1

Gene Name

lnc-SPRR2D-2

Start

152965130

CPC Label

noncoding

End

152969316

Cancer

OV

Strand

-

Peptide

FPSEIQSSGTILNTTFPMAPFPNLSQK

Modified Peptide

n[145]FPSEIQSSGTILNTTFPM[147]APFPNLSQK

Peptide Length

27

ORF Length

105

Open Reading Frame (ORF)

MLHLSKPPHSTSLSATLLPVFNLSWCPTPRFPSEIQSSGTILNTTFPMAPFPNLSQKMCFPPLLNIHSFYLSVSHLSLTLTKRILYPLHTCEPANGHMNKWVDDI

Conservation Score

0.815

PhyloCSF Frame 1

-5.971

No. of Spectra

5

CPC Coding Probability

0.133728

PhyloCSF Frame 2 

-2.974

CNTI Index

noncoding

Max Probability

0.679

PhyloCSF Frame 3

-5.049

CNTI Score

-0.418822413