McDonnell Genome Institute

Washington University

Transcript

lnc-SPRED2-9:1

Chromosome

chr2

Gene Name

lnc-SPRED2-9

Start

65500992

CPC Label

noncoding

End

65502138

Cancer

BRCA-Basal-like

Strand

-

Peptide

QSGPASSWGFPPR

Modified Peptide

n[145]QSGPASSWGFPPR

Peptide Length

13

ORF Length

79

Open Reading Frame (ORF)

LEVRRGASDEDLKKAYHKLALKFHPDKNHAPGTTGAFKAIGTAYAVLSNPEKRKHMTTWAITGVRQSGPASSWGFPPRL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.107475

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9993

PhyloCSF Frame 3

0

CNTI Score

0.693056129