McDonnell Genome Institute

Washington University

Transcript

lnc-SPRED2-2:1

Chromosome

chr2

Gene Name

lnc-SPRED2-2

Start

65589565

CPC Label

noncoding

End

65640177

Cancer

OV

Strand

-

Peptide

LTAASLPDSPASACPVPAIAGAR

Modified Peptide

n[145]LTAASLPDSPASACPVPAIAGAR

Peptide Length

23

ORF Length

87

Open Reading Frame (ORF)

LLCGINLKMSNFSSDATRLKAVHDPLYKEVYLGSPSPSPSPSPHGLPLMPSRSWTVLLPSRLTAASLPDSPASACPVPAIAGARRHA

Conservation Score

0.111

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.231885

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9847

PhyloCSF Frame 3

0

CNTI Score

-0.340078225