McDonnell Genome Institute

Washington University

Transcript

lnc-SPRED2-1:2

Chromosome

chr2

Gene Name

lnc-SPRED2-1

Start

65450352

CPC Label

noncoding

End

65455697

Cancer

CCRC

Strand

-

Peptide

SMNGEVK

Modified Peptide

n[230]SMNGEVK

Peptide Length

7

ORF Length

51

Open Reading Frame (ORF)

MIAPHPAPNTSTQLNFLLNKSMNGEVKRNQKLGLQKSLMEEFQDSRSGQPC

Conservation Score

1

PhyloCSF Frame 1

-4.467

No. of Spectra

7

CPC Coding Probability

0.0387709

PhyloCSF Frame 2 

-5.833

CNTI Index

noncoding

Max Probability

0.9961

PhyloCSF Frame 3

-5.187

CNTI Score

-0.383605726