McDonnell Genome Institute

Washington University

Transcript

lnc-SPR-3:1

Chromosome

chr2

Gene Name

lnc-SPR-3

Start

72288784

CPC Label

noncoding

End

72289110

Cancer

HCC

Strand

+

Peptide

HGYIGEFK

Modified Peptide

n[230]HGYIGEFK

Peptide Length

8

ORF Length

73

Open Reading Frame (ORF)

LCSKVIVQFLTVLLKHGYIGEFKIIENHRAGKIIVNLTSRLNKCGVISPRFAVQLKDLEKWQNNNPASLVSLY

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.00800104

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5464

PhyloCSF Frame 3

0

CNTI Score

-0.444186609