McDonnell Genome Institute

Washington University

Transcript

lnc-SPP2-10:1

Chromosome

chr2

Gene Name

lnc-SPP2-10

Start

234497207

CPC Label

noncoding

End

234500468

Cancer

OV

Strand

+

Peptide

AAAVGDAACLR

Modified Peptide

n[145]AAAVGDAACLR

Peptide Length

11

ORF Length

92

Open Reading Frame (ORF)

LPLRAAAVGDAACLREWVPGSQLCGREAGQGGPQGDWESAALGSEGGEAGASKPQKGRDGAGLGELPACALDPAGRVPSHPRAAAVAGPGPQ

Conservation Score

0.09

PhyloCSF Frame 1

-4.361

No. of Spectra

12

CPC Coding Probability

0.0294151

PhyloCSF Frame 2 

0.492

CNTI Index

noncoding

Max Probability

0.7295

PhyloCSF Frame 3

-2.304

CNTI Score

-0.294671403