McDonnell Genome Institute

Washington University

Transcript

lnc-SPOPL-9:1

Chromosome

chr2

Gene Name

lnc-SPOPL-9

Start

138307318

CPC Label

noncoding

End

138307970

Cancer

BRCA-Luminal A

Strand

+

Peptide

KNVTLNPDPSEIK

Modified Peptide

n[145]KNVTLNPDPSEIK

Peptide Length

13

ORF Length

37

Open Reading Frame (ORF)

LFVRKNVTLNPDPSEIKSYCYVSKEELKELGEKSSQL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.108325

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5683

PhyloCSF Frame 3

0

CNTI Score

-0.405303834