McDonnell Genome Institute

Washington University

Transcript

lnc-SPOPL-10:1

Chromosome

chr2

Gene Name

lnc-SPOPL-10

Start

138278573

CPC Label

noncoding

End

138279210

Cancer

OV

Strand

+

Peptide

HADWATKPSK

Modified Peptide

n[145]HADWATKPSK

Peptide Length

10

ORF Length

57

Open Reading Frame (ORF)

LLSTGLAQSGSSLLSTGLPAPPSPIKHADWATKPSKVTLYIGFVFAVVAGNAQFLRL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.0949451

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9765

PhyloCSF Frame 3

0

CNTI Score

-0.338276251