McDonnell Genome Institute

Washington University

Transcript

lnc-SPOCK2-3:1

Chromosome

chr10

Gene Name

lnc-SPOCK2-3

Start

72053293

CPC Label

noncoding

End

72054037

Cancer

OV

Strand

-

Peptide

GPVHLLSC

Modified Peptide

n[145]GPVHLLSC

Peptide Length

8

ORF Length

51

Open Reading Frame (ORF)

LSWRASLGPGNAQLFNMKLPQDPQDHPGGAPIRRRKTPGPGLRGPVHLLSC

Conservation Score

0.096

PhyloCSF Frame 1

-4.238

No. of Spectra

3

CPC Coding Probability

0.0792765

PhyloCSF Frame 2 

-3.847

CNTI Index

noncoding

Max Probability

0.6191

PhyloCSF Frame 3

-4.351

CNTI Score

-0.289645908