McDonnell Genome Institute

Washington University

Transcript

lnc-SPOCD1-4:2

Chromosome

chr1

Gene Name

lnc-SPOCD1-4

Start

31785242

CPC Label

noncoding

End

31788606

Cancer

BRCA-Luminal A

Strand

-

Peptide

DSSVSTCVGGNK

Modified Peptide

n[145]DSSVSTCVGGNK

Peptide Length

12

ORF Length

133

Open Reading Frame (ORF)

LRCLGWSRTGMEGRLRAETAWRATCLFLYQRGLGNPGATPLPFLSLSFPVVGSKDSSVSTCVGGNKSAQYGEPSRCCSYVTVPWREFPVLCTVQAEAERDPLSVLDRSSRIPGGSCSFKNWGWLLSCVEEDCW

Conservation Score

0.983

PhyloCSF Frame 1

-3.73

No. of Spectra

1

CPC Coding Probability

0.363691

PhyloCSF Frame 2 

-1.591

CNTI Index

noncoding

Max Probability

0.7141

PhyloCSF Frame 3

-3.398

CNTI Score

-0.327442335