McDonnell Genome Institute

Washington University

Transcript

lnc-SPNS3-2:2

Chromosome

chr17

Gene Name

lnc-SPNS3-2

Start

4163909

CPC Label

noncoding

End

4164713

Cancer

OV

Strand

+

Peptide

DVVTANSTHLPK

Modified Peptide

n[145]DVVTANSTHLPK

Peptide Length

12

ORF Length

54

Open Reading Frame (ORF)

MCACSFCPATAPPLGSHRDVVTANSTHLPKKSKSSRRAVSTQDSLAAENQCCQL

Conservation Score

0.995

PhyloCSF Frame 1

-3.371

No. of Spectra

21

CPC Coding Probability

0.053163

PhyloCSF Frame 2 

-3.375

CNTI Index

noncoding

Max Probability

0.993

PhyloCSF Frame 3

-3.797

CNTI Score

-0.413730635