McDonnell Genome Institute

Washington University

Transcript

lnc-SPNS2-4:1

Chromosome

chr17

Gene Name

lnc-SPNS2-4

Start

4555502

CPC Label

noncoding

End

4556542

Cancer

OSCC

Strand

+

Peptide

SLVSLMQGQAWIR

Modified Peptide

n[145]SLVSLM[147]QGQAWIR

Peptide Length

13

ORF Length

72

Open Reading Frame (ORF)

LSDKKGPPPPYSCKDLRGRNPKPCNYRDPGLEGLRLARSKAAWGPGLGFHSEGDGKSLVSLMQGQAWIRFTF

Conservation Score

0.177

PhyloCSF Frame 1

-3.448

No. of Spectra

2

CPC Coding Probability

0.0198448

PhyloCSF Frame 2 

-2.761

CNTI Index

noncoding

Max Probability

0.7628

PhyloCSF Frame 3

-3.781

CNTI Score

-0.353257311